DPCstruct | MC16090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 45.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392NCT7 | 2-67 | GVHAFIVPIRDMKTHQTLPGIEIHDCGHKVGLNGVDNGALRFRSVRIPRDNLLNRFGDVSRDGQYT |
| A0A1B0BWU1 | 23-85 | APFIVHIRDEETHMPVPGVDIGEIGPKLGMKSGNNGYLGFKNARVPLNHMLMKNQQVLFDGTY |
| A0A6G1C406 | 2-67 | None |
| A0A822HXL6 | 128-185 | None |
| A0A6A4FYR4 | 166-231 | None |
| A0A6A6EVM1 | 19-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.