DPCstruct | MC1609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 166 ± 24 aa |
| Standard deviation of domain lengths | 24.42 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N8LFR2 | 3-152 | TTTVGLNDEELARIEGEFGFEFADDHRAFLSSGLPVGDSWPDWRSASRRSLHQRLRLPAEGILFAVEWQDFWGSDWGVRPARIKDAL… |
| E3CDD0 | 6-135 | TDEVFTKIEETYGIILPNEFKQVYCDLEQLPNGWYNWADFSRENTDCLKKQMEEVMGEITDEIDEIEWNDNWGECPNTIHEVHHFIK… |
| A0A7N0U9I7 | 13-165 | None |
| A9RNF0 | 48-250 | None |
| A0A4R3BAS2 | 1-127 | None |
| A0A7N0T553 | 9-196 | None |
| A0A7N0TDP7 | 15-180 | None |
| A0A1I3DJD7 | 1-136 | None |
| U5CM77 | 68-245 | None |
| A0A6A6L5X1 | 28-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.