DPCstruct | MC16088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 199 ± 38 aa |
| Standard deviation of domain lengths | 37.83 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 33.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05914 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401SEM1 | 38-222 | IGIDKQALDGQIKDKKIHEETEARKHLAYAKDLIRHDQTMCLLDARHKRDVKNLNKAIGEFRICYQKPETRREFDLNDPQALKKNVP… |
| A0A402G3X4 | 21-197 | LLFPLKVDVEGLKKQVEERKLREEAEKRRDEAFDADRVQYDKIAQMLEEEEQERKRRLNQALEEFRQHKQQPSTRREWDIHDPAAQR… |
| A0A819LCU8 | 1-161 | None |
| A0A3Q3VJE3 | 13-181 | None |
| A0A3Q2CEF2 | 1-212 | None |
| A0A3P7L200 | 4-140 | None |
| A0A6P4VXT4 | 37-236 | None |
| A9V4R6 | 14-326 | None |
| A0A5N5NVX1 | 1-214 | None |
| A0A6H5IDU8 | 7-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.