DPCstruct | MC16083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 57 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183G2U3 | 2-46 | GEYGASLEELRALMEYRGAEAKEKIDADYGGITGLCERLKTDPNN |
| A0A402G2S1 | 1-65 | MANSSVDFYPKNQRRELNHAGGFGCTLSELRSLMELRGGEAIQKVQETYTDVNGLCRRLKTSPTE |
| A0A5C6MPR4 | 10-82 | None |
| A0A4Y2E556 | 3-56 | None |
| A0A183CNE2 | 50-103 | None |
| A0A0N8K0V0 | 1-65 | None |
| A0A833YJ34 | 1-64 | None |
| A0A1I7WEY4 | 2-46 | None |
| A0A1S0TGZ7 | 3-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.