DPCstruct | MC16082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 26 aa |
| Standard deviation of domain lengths | 26.06 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4L2J1 | 17-101 | TSHCLGSGDILISCLGDPAGNGKGGFILLDGETFEVKGNWEKGDKVPPLGYDFWYQPRHNVLISSEWGAPKVLADGFNPADVERG |
| A0A402G299 | 22-100 | LGCGDVMISAVGDPRGNGKGGFALLDAETFEVKGNWERPTQAAPMGYSFWYQPRHNVMMSTEIGVPKFFINGFNPADLG |
| A0A2Z6MJK0 | 91-163 | None |
| A0A8B6ELA8 | 102-218 | None |
| A0A3M0LBY1 | 259-362 | None |
| A0A2P4SJU7 | 9-151 | None |
| A0A3P6QSC5 | 44-180 | None |
| A0A1V4JZW2 | 1-66 | None |
| A0A7J5XPU0 | 718-825 | None |
| A0A7R9BET7 | 1-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.