DPCstruct | MC16081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 92 ± 4 aa |
| Standard deviation of domain lengths | 4.16 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A341BUE8 | 2-96 | KFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIRVFFVKYNDPICMKLEKLDIMIRLASQANI… |
| A0A402G267 | 3-98 | MSVAQLYFHLAPKAEVGVIAKASVRLLRSHSEVQYVVLQNVATMSIKRRGMFEPYLKSFYIRSTDPTQIKILKLEVLTNLANETNIS… |
| A0A438JY42 | 68-162 | None |
| F0Y5W5 | 403-488 | None |
| A0A183WJK4 | 2-96 | None |
| A0A2R6WW60 | 369-451 | None |
| A0A7S0DI80 | 46-132 | None |
| A0A1Y3EA41 | 397-490 | None |
| A0A814I4N1 | 678-772 | None |
| A0A0P5R4N7 | 315-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.