DPCstruct | MC16080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401QD85 | 41-102 | EEVVVATTRPETMLGDVAVVVHPDDGRYTHLVGKQIRHPFTGRLLPILTDTLVDREFGTGAV |
| A0A402G248 | 1-58 | DEVVVATTRIETMLGDTAVAVHPKDPRYRHLHGRSVRHPFTGRLLPIVCDDFVDMEFG |
| A0A1A9X9U2 | 96-153 | None |
| A0A449ASK2 | 30-106 | None |
| A0A1R0H6U5 | 143-219 | None |
| A0A4S4ETM5 | 432-490 | None |
| A0A7J7MEV4 | 63-121 | None |
| A0A7J8VSF6 | 11-86 | None |
| A0A377XNM8 | 23-83 | None |
| A0A536I0N7 | 210-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.