DPCstruct | MC16078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.48 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | PF05667- PF21674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G1Z6 | 6-131 | VESIREFTTELIVEAVVRCLRVINPSVGAGLSHILPPGMSARFRIGMSLAQAFQDLGYQGEIGYQTFLYSSEPEIRRLLLFLVEKLP… |
| A0A2R7WIS9 | 18-124 | DINDEIDSLEGFTTDIVIDATVRCLEIIKPETNISRTLPQNMAARFHLGSAIAEACKNLGYSGEVGYQTFLYLNVGDVRRVFMFLIE… |
| B4DLA4 | 28-167 | None |
| A0A5A8C378 | 22-156 | None |
| A0A1X7T484 | 27-163 | None |
| D3B059 | 380-512 | None |
| A0A2I0VKN5 | 23-144 | None |
| A0A5N6M017 | 26-135 | None |
| A0A822BGG8 | 18-145 | None |
| H9IVE1 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.