DPCstruct | MC16077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 8.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15797 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G1M8 | 5-111 | AAAIAASRTAVMTGNRPLDERERKRFSYFSSLSPMARKIMAEKERIRERYGPEWDRLPPSQQDEVIDKTLVEPHVQARYAAHRGAAR… |
| A0A674NFK4 | 7-105 | AGLSAQRMEKIKFEYFSSINSMARKIMQERERIKARHGPTWEKMTPQEQENAIDSGIVDPHIRARYAMHRIDREDVDCYPKLKIETG… |
| A0A0A1WX79 | 12-107 | None |
| A0A6I9P9H4 | 1-106 | None |
| A0A662YQW9 | 1-102 | None |
| A0A5N5JD24 | 1-104 | None |
| R4GKY7 | 89-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.