DPCstruct | MC16076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 55.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9PQC2 | 323-400 | MPDTGGANIPALNDLLSVWNMAFSDGIYEGDFTMANHDMYYASGSSIAKFPEDGAVLSQTLKDQGLEVLKQETSLVEN |
| A0A402G1K6 | 1-77 | MPDTGGANIPALNDLLSVWGMAFSDGLYEGDFTLANHEMNYASGCSIAKFPEDGMVIAQTFKDQGTELPFILHSLCV |
| A0A2R7W2L5 | 1-95 | None |
| T1FVU8 | 580-655 | None |
| A0A5E4PK15 | 942-1026 | None |
| A0A7E4RVB3 | 200-276 | None |
| A0A402E7V7 | 53-129 | None |
| A0A7J8P6Q8 | 85-169 | None |
| A0A226MRJ8 | 950-1027 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.