DPCstruct | MC16072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540NNR4 | 1-86 | MHDTLDEIVLYSTVACGPLSVILMKGQCLRLLPAPLAGCEKALLWSWDGSTIGGLGGKFEGSLVNGSVLLHCLNSFLKYSAVLVQP |
| A0A3P7DQ80 | 643-746 | PHFGTVIPEVVSSWFRLFLYYTLGDGPVSLYIPKGSRVPVIPCALRQCKHLLITTASHEPVIIPADNCLIQLNDILQTHAVFVQEYS… |
| G5BAU0 | 405-523 | None |
| A0A3Q0IMV8 | 500-600 | None |
| A0A0C2M3F5 | 1-116 | None |
| A0A5A9NQJ8 | 441-560 | None |
| P0C866 | 160-279 | None |
| A0A813T2E5 | 552-640 | None |
| A0A6A2YMF8 | 361-457 | None |
| A0A426XDG5 | 267-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.