DPCstruct | MC1607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 437 ± 59 aa |
| Standard deviation of domain lengths | 59.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.64 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF20220- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4LN90 | 13-467 | ITRVAKAAALFNALRPTVSSFAFLIQHAASFNWLNPAALPLSPPAGTVYLPFERLLQALQLNRRQTASAPRLFDVLGRWVQVLPADL… |
| A0A258LJ27 | 23-352 | PTPMITQSAYLAGLVAASNNTWSVNDLAALTGASGFNFTYPDSYWDPATLARLTTCFTALALLGTNVANVRAWINAEITVAQANDIV… |
| A0A0G4NPH8 | 277-665 | None |
| A0A6L9ZR88 | 21-370 | None |
| A0A0L0LZ72 | 682-1148 | None |
| A0A4D7JP61 | 492-993 | None |
| A0A0D8L8E9 | 3-419 | None |
| X7YBI6 | 1-497 | None |
| A0A2S8PY88 | 540-1030 | None |
| J7TP80 | 212-687 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.