DPCstruct | MC16065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 165 ± 20 aa |
| Standard deviation of domain lengths | 20.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6V7G1 | 571-736 | FLRTPNNQALKLTNGFVYWTPRPGELDACDAAAASFVSMSSAVQYAREFAQPSLRLFSSIHETVVLDPENFLRFNDGVLQASLLRAA… |
| A0A2S9AL56 | 4-149 | ATHAEVYFTISSVLHRARHSKDAKFSLFEQPGFGHVLSPANVDRFNDPVIQAAILRAARGTELHFDNLEQQSRHMAAAIETAVRSWS… |
| A0A4Q9VIS3 | 547-716 | None |
| A0A3D5VSM3 | 50-221 | None |
| A0A1F9IVZ8 | 19-223 | None |
| A0A4R0XK24 | 168-338 | None |
| A0A3N8DKT0 | 3-129 | None |
| A0A0B4XPH9 | 238-407 | None |
| A0A2Z5AH02 | 216-382 | None |
| A0A159ZWF8 | 5-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.