DPCstruct | MC16064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 157 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0020- PF08146 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0P8R1 | 63-247 | EKFKSIVTNYFSHVLDDTIELLQKEKDDTFCLKSDLWEAIINSIHQNLLYDTEEFWQNSTRFSKMAPVLISHLSFTPRYKVDKYLIP… |
| A0A2P4YHT4 | 14-172 | GHNTLLMVTVVRAMDGCFVHDNDGFIEKDRFDVVLAPLVDVLDVLQYDASMREFVLETVAPCLANLAWAAKSDLLWKPLHYAELMKS… |
| A0A060XD41 | 2-125 | None |
| C9SUW1 | 255-414 | None |
| A0A7J6PYY0 | 2-154 | None |
| A0A6L5CU51 | 452-617 | None |
| E9I3S2 | 65-223 | None |
| A0A7S3FYX5 | 1-175 | None |
| A0A077ZJY6 | 1494-1642 | None |
| A0A3P7DII4 | 170-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.