DPCstruct | MC16063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 76.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225UDN0 | 1-68 | MDRSEFPHLTDSQFESIRKMAGIFGMDAFWSLATATPAEQVERVNAFDMYERGLIKHVRGNLQAPVAE |
| A0A2P4Y0K9 | 8-64 | TAIGEFPHLTDSQFESVRKMVGIFGGYALRSLAAATPAEQVERIEAFDTYERGLIAH |
| A0A2P4X4P2 | 1-61 | None |
| A0A2P4X8B0 | 1-67 | None |
| H3GXG2 | 1-57 | None |
| A0A2P4XFI3 | 1-65 | None |
| A0A2P4XME6 | 1-66 | None |
| A0A2P4X475 | 1-67 | None |
| A0A2P4X9G8 | 14-79 | None |
| A0A2P4X0K3 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.