DPCstruct | MC16062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 226 ± 44 aa |
| Standard deviation of domain lengths | 44.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4YCZ4 | 2-274 | IDKILQVTHSYEVIRPLSPNSLIPWQSVLRFALDKNVQALIDTGALLAGVTNCDAADYLLKHPSFDLGGVTYYDSEEHNCWMIAEKT… |
| A0A821FPE3 | 5-181 | NTKELLEKFCEYAKKNQNCYVLIDAGALITEMSNFNVSKYLIERIDERFSGIVYFSDESNKIMVILRNEESFPLSTCHIDNKKLFVY… |
| A0A820GB90 | 52-208 | None |
| K3W594 | 5-167 | None |
| A0A081AKS4 | 80-335 | None |
| A0A817GXV2 | 503-720 | None |
| A0A194XJ18 | 419-671 | None |
| A0A7S1Q8W8 | 34-272 | None |
| A0A822DX26 | 747-956 | None |
| A0A812J0P5 | 187-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.