DPCstruct | MC16061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 414 ± 39 aa |
| Standard deviation of domain lengths | 39.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.73 |
| Pfam Score | 69.05 |
| Assigned Pfam label(s) | PF03177- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059JD43 | 426-805 | LAVQFDKPAAEIAVLTNTGVHIIRRRRLVDMFASLIRNSDGEDGLEDRVQTFIRIYGRSETIATALAVACGQGMEVSPDSRLSKIND… |
| A0A2P4YAD6 | 18-435 | GEMALMYSQPSRHFVCLTNAGIQIFKKIRPLDQLHRVLMLARGHELKAALVPFVRCFGEIQVVCMLIALACGVPTDPLVSESSTAAS… |
| A0A2P6S475 | 43-383 | None |
| S9TRY2 | 328-827 | None |
| A0A1D6PG78 | 45-476 | None |
| A0A835IVH6 | 6-377 | None |
| A0A183HD59 | 1-388 | None |
| W6NE01 | 73-465 | None |
| A0A673MGZ5 | 485-907 | None |
| P38181 | 628-1057 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.