DPCstruct | MC1606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2 |
|---|---|
| Mean domain length (aa) | 100 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4V6N9 | 830-934 | TLFTAEGLIRSWVRSSMKGVTTEEGVTAHAYLRWLLTQGERPNNRIDLLDEDEKGWLFGQAELHNRRAPGNTCLSALRDMPALGEPA… |
| A0A7G1IKG6 | 9-102 | TLFTAEGLLRYLVRGRIKGLSTYTGVTANAYLRWLRTQGEAPVHPVGVGEPFGDGQSGWLYQQRQLHSQRAPGNTCISALRGIRNLG… |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.