DPCstruct | MC16059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 244 ± 20 aa |
| Standard deviation of domain lengths | 19.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8DAA9 | 195-448 | AVRVFNLVRSRFDPNDLYLITMSFNIQEFEIRELKKKGPAMVGILTLVQDMQAETVDTFYMVALRYPYERVPTFELYERVGVTSDSY… |
| A0A2P4Y869 | 32-261 | KTVARIYYLTRQKSNPKNVLLLSTMLSAQDYEVAQQFQRGAGMVLLVTAIDDMQTPELTHHIAVALNYPYAAEPEFAYSELQGIDGD… |
| A0A6G0W9I9 | 109-343 | None |
| D0NQA1 | 36-288 | None |
| A0A067CPJ0 | 111-345 | None |
| A0A067CXB2 | 150-402 | None |
| W4FYT9 | 12-298 | None |
| K3X336 | 28-280 | None |
| A0A485KUA8 | 91-289 | None |
| A0A3R6VB48 | 157-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.