DPCstruct | MC16058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 7.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2V3G9 | 145-250 | IDLVQVESDNTLVCTESGNTFTIEFWVPTSNLPDIEVTNNGLDSITIETTQDGSKEWAECSNRGICDFTTGSCVCFDGMGSSNGMAD… |
| A0A2P4Y3C8 | 9-122 | RITSVSVTFSTGTSACSSAGNAMTITFYSPSGDVPLLSISAATLTHSTATVTTNVVQTTQGTKEDTICNNRGRCDEDTGTCICSLYH… |
| A0A7S2UTE6 | 150-267 | None |
| A0A1V9YVD8 | 578-697 | None |
| A0A2P4YQC4 | 215-327 | None |
| A0A024U4P1 | 393-504 | None |
| A0A5A8CL77 | 324-430 | None |
| H3HE27 | 371-470 | None |
| A0A5A8E0G2 | 688-794 | None |
| A0A7S1XM25 | 839-943 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.