DPCstruct | MC1605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 287 ± 21 aa |
| Standard deviation of domain lengths | 20.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G1IK04 | 2-298 | SLSSDDTPTGPIMGARPPAPPGQPRDSLRRWNINRDVASSVLVVSALFFPWNLYFGFRIPGSSRILFGVLLLVTLLSLTAAVVPHLG… |
| A0A4Y3KFF0 | 148-454 | QGYAGHAPFAGPTTHAPGAGAPRTRASAFQGVPVRDYVTDGVALVLLLVTLGLGWDFRYAASERIEVVLVTVVSILSLSLFYLARSG… |
| A0A7D6Z6W2 | 200-500 | None |
| A0A5B7R6E2 | 85-399 | None |
| A0A6G9CM64 | 3-290 | None |
| A0A0S2LV68 | 37-328 | None |
| A0A318RH37 | 1-275 | None |
| A0A1A3JHD2 | 1-289 | None |
| D1BEZ6 | 16-249 | None |
| A0A1Q9VVJ5 | 34-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.