DPCstruct | MC16047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0413- PF06862 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816HYM2 | 13-70 | VMHRVLNVAEKNDAAKSLARLLSKNSASMREGFSRFNKIYEFNYQLLNQPVQMFFTSV |
| A0A401P484 | 2-80 | VAEKPSLAQSIAKILSRGNFNSRKGLNGVCSVHEYPGTFLGQSVRFKVTSVCGHVMTLDFIDFGDERIGTLTNSSYADK |
| A0A7C1BJJ6 | 4-83 | None |
| A0A812JUV4 | 373-458 | None |
| A0A2M6YEM3 | 2-84 | None |
| M1UQ11 | 1-102 | None |
| A0A1Y3BQZ6 | 1-89 | None |
| A0A4S4DAG9 | 107-198 | None |
| V5BIM8 | 32-117 | None |
| A0A7J6Q5M4 | 3-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.