DPCstruct | MC16044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 202 ± 36 aa |
| Standard deviation of domain lengths | 36.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 97.26 |
| Assigned Pfam label(s) | PF00784- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0TVW8 | 229-405 | EENRNSPEVLEQIYHNNPILCYTAGPLYAPLLPFPYAAPGGQGYAGLRDEAVKLFHSLQQLEGVREPALLMQGVLQTCHDLPPLVDE… |
| A0A401P1V7 | 9-202 | MPSASCVFPGFMLRKPSSETDIENWASKHFNKHTQGIFRRKVSIANMLAWSSESIKKPMIMTADRNVKKEACEVFKLIQMYMGDRRA… |
| A0A1I8HYK1 | 153-380 | None |
| A0A199VU23 | 33-292 | None |
| A0A6P6QIY2 | 42-209 | None |
| E9QEL6 | 1786-2028 | None |
| A0A7R9KLJ7 | 470-661 | None |
| A0A2G8L316 | 332-588 | None |
| A0A1V9YPI5 | 949-1164 | None |
| A0A1Y2HBG8 | 15-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.