DPCstruct | MC16043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401P079 | 1-92 | MKRLRCNDDNDCADYSDEDNCESYNSPCRKFLEPLEVARTAGSGVNIFGLEPRRSAFNNEFYNGQCDRVYDGLRRTYFRLPWNVMSF… |
| A0A2J8QA93 | 150-243 | RCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANL… |
| H2YXX7 | 2-109 | None |
| A0A2I0U7B6 | 51-155 | None |
| A0A1A8HST3 | 98-194 | None |
| A0A5E4C303 | 144-246 | None |
| A0A4Z2E521 | 7-114 | None |
| L8Y4M8 | 165-262 | None |
| A0A7J5YKV3 | 132-232 | None |
| H2YXC1 | 115-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.