DPCstruct | MC16042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 212 ± 17 aa |
| Standard deviation of domain lengths | 16.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 73.48 |
| Assigned Pfam label(s) | PF00086- PF00095- PF21283- PF18635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553QFP0 | 1-196 | MKLFFAVCVVALLETVASQCTCQSMKWATCDDSCVCTLPFADNYKQTIDCTKLIPKCFLMKAEMYRAKKNMSTRSIVCWCVNSAGVR… |
| A0A401NX90 | 39-267 | TAIPDMGKRGCLFVVVVMVDYVCMVSAIPDDECPDAYPARENCEFDEVCEDASCKYNQYVTCHLNRCGTCEAVFRGYDNVTVSCNQL… |
| A0A6P3RK66 | 8-222 | None |
| M7BWP6 | 488-682 | None |
| A0A1S3JDT3 | 768-1005 | None |
| E9HCH8 | 503-722 | None |
| B3SAJ2 | 747-927 | None |
| A0A2K5PXI9 | 7-203 | None |
| A0A6P3H059 | 152-377 | None |
| A0A6P3IR35 | 68-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.