DPCstruct | MC1604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 151 ± 15 aa |
| Standard deviation of domain lengths | 14.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S3UPJ7 | 111-266 | IHPGLIGCLPDHKMLAEWNRREQELIDTDPGRVPPLANPPHAKTAHLGKMKGGPERDLAAATGARTVPPREHGGNCDIKDLSRGSKV… |
| A0A7G1IJZ9 | 1-147 | MEPARGALIATDPDRVPPLALPPEPDGAILGALTGDEFARVAAEAARTAPPRENGGNQDIKNLTKGTRVFYPVFVPGANLSFGDLHF… |
| A0A0N0RU05 | 153-314 | None |
| A0A094HDD5 | 130-286 | None |
| H1UUZ0 | 50-214 | None |
| A0A2Z3J983 | 7-162 | None |
| A0A0L6WTU0 | 140-299 | None |
| W6QLH0 | 43-200 | None |
| A0A6G3VJT2 | 106-217 | None |
| A0A7C7CD50 | 39-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.