DPCstruct | MC16035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 359 ± 51 aa |
| Standard deviation of domain lengths | 50.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3H8M8 | 12-335 | NDCKTLDRLLFFAQSLEEKLFDYTIDSYKARALNIHTLLYELSAVCEKVIEARLSTGVLIPLIEELKQLINIDPVISEEERTHFRIY… |
| A0A417D6C6 | 11-258 | TKDGYLFFVQRLQEMLFHYSDDIVKAPVHNTQTLLEEYVDTEKDVVKGSIKQYQLDIIAKEIKSSLMTDVIVRELYKYEVIEEMAKF… |
| A0A3R6P1I7 | 21-414 | None |
| A0A017TCJ8 | 11-405 | None |
| A0A6M1U8W9 | 9-316 | None |
| A0A656QA19 | 5-366 | None |
| A0A0K3A5Z8 | 17-434 | None |
| A0A7W7HLS0 | 27-413 | None |
| A0A1H2I0R6 | 15-378 | None |
| A0A7X6R4G8 | 7-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.