DPCstruct | MC16033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 300 ± 59 aa |
| Standard deviation of domain lengths | 59.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5QNS9 | 39-291 | PGRDEDTLFVARCQVRRRLGTGSALNIVLQELSAAVLEGWPGAPPLTRDRSVRRPAARFEGLVWDVEGDAGAWRGELLWRRPHPVIA… |
| A0A7C3H572 | 1-348 | MLAFRRTFYVEKANETEGEITKYEDLFQAVSESLQTTLVELLPDDWNETVVDGWPNIHRKGDDGRPQLEMSLWEPKSGQAPRLLEMT… |
| A0A245ZTW3 | 1-223 | None |
| A0A542FJ19 | 21-325 | None |
| A0A3D9WZJ8 | 1-266 | None |
| A0A837ITU7 | 1-187 | None |
| A0A2R4M691 | 2-299 | None |
| A0A7X8TL72 | 270-548 | None |
| A0A5J5DY96 | 11-350 | None |
| A0A0M0EEV9 | 7-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.