DPCstruct | MC16031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 286 ± 52 aa |
| Standard deviation of domain lengths | 52.18 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.02 |
| Pfam Score | 94.79 |
| Assigned Pfam label(s) | PF17392- CL0063- PF17391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4DQU6 | 14-294 | EKTDSLDEALEMIERWTGAGEAKSVALIGNAADVVPELANRGVRPDIVTDQTSAHDPIHGYLPQGWSVADWRERQESDPKAVERAAR… |
| A0A0B7A9P5 | 10-311 | LVALLRNAKRRKRALSIGYHGNVVDVWERLVTEYESTGELLADLGSDQTSCHNPFHGGYYPVQLNYQQARDMMHQDSVKFKNLVQES… |
| W4SL99 | 180-514 | None |
| A0A0K2QWU2 | 20-283 | None |
| A0A447MVJ3 | 5-227 | None |
| A0A556TR47 | 220-562 | None |
| A0A535YS62 | 648-982 | None |
| A0A3P9KAA8 | 287-595 | None |
| A0A158R5C0 | 97-399 | None |
| A9WN96 | 419-756 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.