DPCstruct | MC16030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 440 ± 40 aa |
| Standard deviation of domain lengths | 39.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1NBD8 | 1-440 | MRRHILLFTISSAVGHHIHLCSMVPCVFGEEDAVMRNLEKESYRFIGQATAILKAIGNVINNFSSKPKLSEALKDLELTHCPPGICG… |
| A0A0B7A8R0 | 1-480 | MCSTYNFLLGDEETIMPHLTSESLCFRENAAQLIANLGKCIMAFSDSEKFTKAYADLVESHCPYLSNKQMSKTQNFQIFNQALYRML… |
| A0A068Y2M0 | 350-791 | None |
| A0A815RV36 | 177-644 | None |
| A0A6A4VKI0 | 518-904 | None |
| A0A816QPC9 | 198-716 | None |
| A0A7D9HHI4 | 3-409 | None |
| G3UZ78 | 764-1205 | None |
| A0A0J7L2H6 | 2-387 | None |
| A0A556TZL6 | 385-811 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.