DPCstruct | MC1603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 498 ± 72 aa |
| Standard deviation of domain lengths | 71.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3XSI5 | 175-702 | LASVLGTSTIPAGEFDRVAEVFVSTRGFGNEFWTGVNAALPGLETQVQDFKQSVEVGLVVKNHLPTMTFMKDKIADPADGRVSSARD… |
| A0A7G1IFW0 | 64-516 | LASVLGTSTIPAGEFDRVAEVFVSTRGFGNEFWTGVNAALPGLETQVQDFKQSVEVGLVVKNHLPTMTFMKDKIADPADGRVSSARD… |
| A0A2N5YUV9 | 18-477 | None |
| A0A1S8A8C6 | 13-474 | None |
| A0A2V7HGE8 | 112-728 | None |
| A0A4D7JI35 | 206-779 | None |
| A0A0L6JIC5 | 13-434 | None |
| A0A656HB14 | 9-503 | None |
| G2YUY3 | 4-608 | None |
| A0A5J5EBY9 | 14-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.