DPCstruct | MC16029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 296 ± 51 aa |
| Standard deviation of domain lengths | 50.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7A767 | 58-369 | TRERDSYRSLLDSYENEVTINFDLEKKAQIQRLEAIVQGYKEQSRELEAELQTVTDKLVETQAQCCQLQQQLNTAISSDQQAPSLED… |
| A0A7S1LZQ0 | 104-367 | AASKAEDECDAQAARVAVLRDAITRGSSEVKVGAEGSQPELEAARKHAAGLEEVVKAKNSALAQLSEELNALRKDISRLSDVDARAA… |
| A0A7E4VUE5 | 261-559 | None |
| A0A226EUJ7 | 441-770 | None |
| A0A6P8VK46 | 12-311 | None |
| H9GGH9 | 12-265 | None |
| A0A2A2KNK2 | 68-319 | None |
| A0A0B1TTG4 | 52-341 | None |
| A0A540MBB5 | 799-1090 | None |
| A0A6A4WU16 | 6-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.