DPCstruct | MC16028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3C4H6 | 52-117 | TPSSSPVPTLTASQQDMLTAFSQKSGMNLEWSQKCLQDNAWDFNAAAQVFTQLKMEGKIPDVAFIK |
| A0A0B7A196 | 38-101 | LSSAVPFLTPAQIQMVESFTAQSGMNAQFALKCLQENAWDYQRAGQIFTDLNAQGKIPAEAFAK |
| A0A5N4DNG1 | 500-565 | None |
| A0A183MTY6 | 288-350 | None |
| A0A433P8F6 | 185-268 | None |
| A0A820MBA8 | 35-103 | None |
| A0A564Y2S0 | 174-244 | None |
| A0A817D6I4 | 541-611 | None |
| A0A2Y9QDX3 | 319-380 | None |
| A0A1I8GAH4 | 567-627 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.