DPCstruct | MC16025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 44.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7X4J7 | 112-207 | SVLANVHYLPSCWRGLAHTHTVRNEFSNLFEFKATFLLNELLSPILTPIILLTHIRPRVLEFVDFFRNFTVEVAGVGDVCSFAQMDV… |
| A0A0B6ZHY1 | 1-88 | MMSILAQIHYMPDHWKGRAHTSHVREEFATLFQYKVVYILEELLSPIFTPVWLMFCLRRKSAQMVDFFRCFTVEVAGVGDVCSFAQMD |
| A0A167EYT5 | 271-365 | None |
| A0A0C9V220 | 574-671 | None |
| A0A0K9RM03 | 1-99 | None |
| A0A4Z2IWV8 | 1-93 | None |
| A0A835R5Y5 | 210-300 | None |
| A0A2P2MKT0 | 144-241 | None |
| A0A146HY55 | 509-601 | None |
| I1CE06 | 53-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.