DPCstruct | MC16020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 316 ± 67 aa |
| Standard deviation of domain lengths | 66.76 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7GFR3 | 34-358 | QTKEMVHSVLERFESEGIENVILLRGDPPQGEDTFVPEAELNVVHEFVHHLQQLHFETAATLESISKNADQTAAYRALIEGDASLSH… |
| D3S1R5 | 39-330 | NFSPELKVVDTNFVLKHWGSYSESEDLFYKAMMILPANYSFKKAKEHDLKSFVAFVWEGKIYVVKENFDKDKFKRTVFHELEHLYQE… |
| A0A4Q2Y0I0 | 3-190 | None |
| A0A6N8VZW5 | 144-540 | None |
| A0A350XSM9 | 24-324 | None |
| A0A0P7I5D3 | 1-231 | None |
| A0A2D6PQ88 | 23-424 | None |
| A0A1E7I482 | 55-460 | None |
| A0A133UCD1 | 119-473 | None |
| A0A3M1TMR5 | 834-1092 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.