DPCstruct | MC16017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 13.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A242A4H5 | 20-161 | ATFTVGAKATFDIQTDGTKAKNIIHFTGISTFKFNDAKNINIQFNLTPIAGSALIYMPRNSYFEIDVQKVNARTTGSDIASEPSYTW… |
| A0A2M9FNI9 | 218-351 | IGGNSSMEINVREGTSFTAIGRSSTASGAIFNGSISNITIDNPLFFDFKNTRPNGGNIYSVSASSIFDLKNSNFAAWTNGSNFDLEA… |
| A0A242K2A7 | 459-571 | None |
| A0A7K3JD06 | 147-270 | None |
| A0A7X1CEQ9 | 290-398 | None |
| A0A7K3JCB5 | 8-155 | None |
| A0A7Z8CUS3 | 50-179 | None |
| A0A6N3FAT3 | 350-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.