DPCstruct | MC16015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 173 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821YU95 | 1-142 | MKSQTYEYYFVSGLGTHGLTADSSGTLISLHVAMKNELQRHVEVYKQALHKLEELSSVTVNQDPASSSHQRLLALSHADVERRLIDN… |
| A0A7E4RID6 | 159-343 | PESVLMQLVKLFAGTGSPERWLGSARKLLKVIVLSEPKLKKALQVKRRALDKAVEGLGQHGLVGTTDESLTNLHDALKVEFQRLVDT… |
| A0A6J0BAZ0 | 123-318 | None |
| A0A0P5GYU2 | 388-548 | None |
| A0A437BHK5 | 5-170 | None |
| A0A7M7KJ10 | 15-177 | None |
| A0A3S3PKV1 | 166-328 | None |
| A0A2G8LD72 | 115-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.