DPCstruct | MC16014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0723 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811WM96 | 1-124 | MAADSDGAGAEAAAGARVVVTCEGDLHDPRFPARLRRLLKDLRALLAEPSPHTLKVNKVEPWNSVRVTLSVPRAAAARLRALAAAGA… |
| A0A814BHX8 | 8-110 | VEISLTCEGNFLDPTLKQKLYDIKDKLQHILHTGRHQHFELKKIEPWNSVKVTFDIPKEAADRLKLLAIQGNKRLKELGILSVEIGH… |
| A0A6J8E1V1 | 171-288 | None |
| A0A674DDV0 | 43-168 | None |
| A0A182F1C0 | 42-148 | None |
| A0A6J8DSV2 | 127-240 | None |
| A0A210QQU4 | 133-233 | None |
| A0A819ESE9 | 1-117 | None |
| A0A1X7VFE7 | 119-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.