DPCstruct | MC16013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 48 ± 2 aa |
| Standard deviation of domain lengths | 1.80 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 53.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2NRP4 | 68-115 | QKRHVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWK |
| A0A811WK15 | 1-47 | MAVLYSPLPETFDDEHQKAQLKRMLDLKVNPVDGLASKWDYENNRWK |
| H3C745 | 71-118 | None |
| A0A6P7F1M9 | 95-144 | None |
| A0A4U5UTQ0 | 161-208 | None |
| A0A1W4W0K7 | 51-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.