DPCstruct | MC16010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 135 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811WCL4 | 159-296 | FLNGLEEVLDVVEPAEFQKVMQPLFRQLAQCVSSPHFQVAERALYYWNNEYIMSLISDNAAVILPIMFPALYRNTKSHWNKTIHGLV… |
| A0A6A1QCG3 | 25-170 | KYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRN… |
| A0A5J4W2T5 | 405-521 | None |
| A0A6P8U735 | 13-141 | None |
| A0A077W743 | 289-431 | None |
| A0A7S3LKZ8 | 161-279 | None |
| A0A183SRW2 | 401-568 | None |
| T1L3F2 | 7-123 | None |
| A0A6V7WQH7 | 12-135 | None |
| A0A5F5XXS3 | 485-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.