DPCstruct | MC16006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.63 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0170- PF04791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444V1E5 | 5-102 | HRLARLGLLSLSCWVLAQGCGPGPGTGHRTRPKKLTPMPYKHFVPNFSENNLGASGRQEGKITRNSERFKDLIPNYNPDIIFKDEEN… |
| A0A811W3W0 | 2-104 | RAAWLILVWAGAAAACGPGRGFTGRRGPRRLMPLVFGQHVPNHGENSQSSSGPPEGRITRDDERFKDLVPNYNPDIDFKDDEGTGAD… |
| A0A6L5C8Z3 | 10-120 | None |
| L8Y929 | 804-896 | None |
| A0A1A9VM48 | 55-172 | None |
| A0A6P4EAX2 | 47-155 | None |
| A0A7D9LFZ9 | 1-122 | None |
| A0A834PAY4 | 69-187 | None |
| A0A3L8RRZ7 | 1-112 | None |
| B7PWA7 | 11-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.