DPCstruct | MC16005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 157 ± 35 aa |
| Standard deviation of domain lengths | 35.25 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6M888 | 1-111 | MILPLDAAFELRIEVMQRFYRRLRGRPAGLPPRALDLTPLRRARLILLLHALDFRLAGAGPRDIAAALIDAEAAALPAIEWKSSATR… |
| A0A1Q9AUC9 | 19-165 | TLTDIRDGSEGRFARHRAGQSEIPLLLLPGAASELPLAALVPLGADARDRVDAIFRFQKALQGLPAPDTRLTELRRWRIPRELRAAD… |
| A9HQH4 | 2-99 | None |
| A0A418NKT6 | 15-155 | None |
| A0A841M9A9 | 23-214 | None |
| A0A7H4KF13 | 209-399 | None |
| A0A2E4QNI7 | 141-350 | None |
| A0A1Q9BTH7 | 341-461 | None |
| A0A501XJ99 | 1-117 | None |
| A0A839ZZA6 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.