DPCstruct | MC16004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 163 ± 40 aa |
| Standard deviation of domain lengths | 40.47 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 70.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 54.93 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF10197- CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1JX61 | 1-140 | MGKGYTNFMCKKPFHPGSRDNIRRVWIAEQKKKFELEKQKELQTLYDKEQEAHKNRKLLNKDDPKMELSFMYNAPPGSSKKEEDGPE… |
| A0A7M7MC33 | 1-115 | MGKGYNNFMCKKDFHPSSIENLKRVWKAEQAAEAEKRKQEDLKAQYEKEQNLYNNRSMVSTESKGKLSLNFMYDAPPGLKREQKDEG… |
| A0A7R9H2N4 | 210-324 | None |
| A0A7I8XGR8 | 1-137 | None |
| A0A7I8VS02 | 1-157 | None |
| A0A813TTJ3 | 1-168 | None |
| A0A7R9KRY4 | 1-156 | None |
| A0A6P7W0U5 | 1-158 | None |
| R7UGL5 | 1-152 | None |
| A0A0S7I413 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.