DPCstruct | MC1600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y0GZS2 | 6-114 | ILALIVGVLLGAVVSAQVPLAMAPYVSVAVLAGLDSICGGSRSYLEGKFQQDIFVSGFLFNILVAIFFVWLGIGIGMNLMLAAGIVF… |
| A0A7G1IB34 | 222-331 | AAGMIGIAALALGIVLGLVFHPSVPEVIQPYLPIAVVAALDAVFGGLRAYLERIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQL… |
| A0A2V2EPD5 | 5-114 | None |
| A0A520EQK1 | 16-123 | None |
| B5Y8D2 | 17-132 | None |
| A0A7X9GZT3 | 5-112 | None |
| K1ZJY3 | 4-130 | None |
| A0A7X8ZC41 | 2-115 | None |
| A0A254QH09 | 23-128 | None |
| A0A7C2BFP4 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.