DPCstruct | MC15999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G6C6I8 | 33-102 | KLTREDKIEIYERRKNGETISSLAKSFNIHESKIKYLIVLIKKHGYDILRNGKNRYYSREFKLQIINRVL |
| A0A4V0HBB5 | 1-74 | MKLNYEDKLEIYRLKKSGVSWTQLEIQFGVNRCNLKYSIRLMDRYGVEIVKKQKYQAYSSEMKQEMINKVLKDG |
| A0A1H7XQA2 | 1-58 | None |
| U2ZPC1 | 1-74 | None |
| T0V9A4 | 1-52 | None |
| E9FPQ6 | 86-147 | None |
| A0A415RND3 | 2-74 | None |
| A0A0Z8BBY9 | 174-237 | None |
| A0A7U7CIG2 | 72-133 | None |
| A0A4J1YZP6 | 20-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.