DPCstruct | MC15998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 134 ± 24 aa |
| Standard deviation of domain lengths | 23.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0405 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3ENJ1 | 30-167 | KKEFVILPLYSTKNGLVPERSGLNQWNANGRRRSLDEVYIPIPIQIHQNFPEFFPSRDEPFDLITPDGQILNAKVCQENSKALMTNP… |
| A0A4U9XZ16 | 32-170 | SPFMGEWIEIRNFNYFYEKFPKFFGPNIGIFIDGSKGKLALDKEKRIFTLRFLPSGDEIEAYINQDNGKAIQSIKNQAILGEWIVNQ… |
| F2F0B9 | 189-329 | None |
| A0A2D9YA58 | 74-215 | None |
| A0A844JRL7 | 264-396 | None |
| A0A7W3TY41 | 199-325 | None |
| A0A5F0TL34 | 2-81 | None |
| A0A3D1AMM2 | 8-111 | None |
| A0A139NE58 | 271-393 | None |
| A0A516HG76 | 3-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.