DPCstruct | MC15996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 63.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A7QZ11 | 1-73 | MLLHDHVLIYADCALNILPTVRQLAEIAIQSADTAKSFGIRPKIAMISYATGNSASGSSVNQVQEATLIVKKN |
| A0A6D0EKX4 | 68-141 | MLLPEQVYVYGDCAINPDPTAEQLAEIAIQSADSAIAFGIEPRVAMLSYSTGTSGAGSDVEKVREATRIAQEKR |
| Q4BXW6 | 315-389 | None |
| A0A520F3D1 | 537-608 | None |
| A0A450THF5 | 1-72 | None |
| A0A381G9W0 | 472-545 | None |
| A0A6G9CP94 | 1-73 | None |
| A0A7C1L7H2 | 177-250 | None |
| A0A4Y4XLZ6 | 1-66 | None |
| A0A2X3JUM9 | 213-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.