DPCstruct | MC15992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 266 |
|---|---|
| Mean domain length (aa) | 188 ± 32 aa |
| Standard deviation of domain lengths | 32.21 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.21 |
| Pfam Score | 85.68 |
| Assigned Pfam label(s) | CL0023- PF00137- PF05695- PF18269- PF00231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A494XQE4 | 324-505 | VLLVFDSLTRYARALREIALAAGELPARHGFPASVFERLPRLLERAGNTGEGAITAFFSVLVDHEDELDPIAHEVISILDGHVVLSS… |
| A0A7J3JVH1 | 2-156 | KRYGSLTIVGAVSPPGADFSEPVTQNTLRYIGTLIALDVSLANRRHFPSVSWLLSYSLYVDNVSTWWSKLNNAWSELRREFLRLLQK… |
| H9GD50 | 165-356 | None |
| A0A0K2RH31 | 1-134 | None |
| A0A6L3EUX1 | 339-541 | None |
| A0A5N6PPI5 | 849-1057 | None |
| A0A1U8FNM3 | 317-515 | None |
| A0A2U1QNX1 | 52-265 | None |
| A0A444WPW6 | 9-167 | None |
| A0A812IZV4 | 93-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.