DPCstruct | MC15990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 167 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8RVV3 | 97-264 | LPVYFEIDGGLLPGVRHFACDRLRATMSVSSCGTRWERADSTDVDADRFHTCRRCSIGAAHAGRLDHNPSQLKGMTICGRCHTGVPR… |
| A0A494X1W9 | 14-184 | QEGAPGKYFACAHYGTMSVNACARNFTDAPHSVKQGRLQRCIGCSVGATHAGVDAPPAASPPSSSIVYRPACVRCRRDGRTQGSRLV… |
| A0A522ISK8 | 155-321 | None |
| A0A6S7AZV4 | 26-202 | None |
| A0A1N6J658 | 27-195 | None |
| A0A437M1K1 | 3-171 | None |
| A0A4R0XEY6 | 97-266 | None |
| A0A7W4VIB0 | 1-150 | None |
| A0A1H7F2R3 | 2-171 | None |
| A0A5C7PW94 | 101-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.