DPCstruct | MC1599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8EPJ3 | 17-92 | IPVNPVLPDLFDDTPNELRTTSELDEWWDRPYALLQPDGTYTVRVLNGGAWDRSTYLGTADSYEVACELAATAQAE |
| A0A0K1QK57 | 59-140 | AEKVEGGVLINPALPPNFSNRDISTRPSEELERWSCRPYIETREVPSGTRYIVSCLDGGAWDRPTDWGSFASINDALVFISE |
| A0A4Q6XAM1 | 12-97 | None |
| A0A811H4D5 | 85-175 | None |
| A0A4U1BY00 | 120-195 | None |
| A0A7Y9G443 | 1-108 | None |
| A2SMV3 | 64-137 | None |
| A0A0H5Q0J3 | 2-92 | None |
| A0A806XYG6 | 16-99 | None |
| A0A2D5PBQ0 | 30-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.